Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPIL2 Rabbit Polyclonal Antibody (HRP)

PPIL2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CYC4, CYP60, UBOX7, Cyp-60, hCyP-60

UniProt

Q13356

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PPIL2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MKIIDPDEEKAKQDPSYYLKNTNAETRETLQELYKEFKGDEILAATMKAP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_055152

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Leptin Polyclonal Antibody 4
TMAB-08277-01 50 μL

Anti-Leptin Polyclonal Antibody 4

Sign In for Pricing
View Details
Anti-Leptin Polyclonal Antibody 4
TMAB-08277-02 100 µL

Anti-Leptin Polyclonal Antibody 4

Sign In for Pricing
View Details
Anti-Leptin Polyclonal Antibody 4
TMAB-08277-03 200 µL

Anti-Leptin Polyclonal Antibody 4

Sign In for Pricing
View Details
VAMP1 Rabbit pAb, PE-Cy7 conjugated
orb2856652 100 µL

VAMP1 Rabbit pAb, PE-Cy7 conjugated

Sign In for Pricing
View Details
M/M046/NT-ALU-DIA200/1-B Safety & Regulatory Compliance Signs (No Adhesive)
135634 1 Pack (1 Panel (s) x 1 Pack)

M/M046/NT-ALU-DIA200/1-B Safety & Regulatory Compliance Signs (No Adhesive)

Sign In for Pricing
View Details
FKBP14 Blocking Peptide
MBS9621720-01 1 mg

FKBP14 Blocking Peptide

Sign In for Pricing
View Details