Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPIL2 Rabbit Polyclonal Antibody (FITC)

PPIL2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CYC4, CYP60, UBOX7, Cyp-60, hCyP-60

UniProt

Q13356

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human PPIL2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GRVVGGFDVLTAMENVESDPKTDRPKEEIRIDATTVFVDPYEEADAQIAQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_055152

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ST18 (NM_014682) Human Untagged Clone
SC315865 10 µg

ST18 (NM_014682) Human Untagged Clone

Sign In for Pricing
View Details
Mouse Monoclonal LIFR alpha Antibody (12D3) [DyLight 488]
NBP3-18054G 0.1 mL

Mouse Monoclonal LIFR alpha Antibody (12D3) [DyLight 488]

Sign In for Pricing
View Details
SPTLC1, CT (Serine Palmitoyltransferase 1, Long Chain Base Biosynthesis Protein 1, LCB 1, Serine-palmitoyl-CoA Transferase 1, SPT 1, SPT1, LCB1) (MaxLight 550) discontinued
S5382-01-ML550 100 µL

SPTLC1, CT (Serine Palmitoyltransferase 1, Long Chain Base Biosynthesis Protein 1, LCB 1, Serine-palmitoyl-CoA Transferase 1, SPT 1, SPT1, LCB1) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Recombinant Thermobifida fusca 1,4-alpha-glucan branching enzyme GlgB (glgB), partial
MBS1419423 Inquire

Recombinant Thermobifida fusca 1,4-alpha-glucan branching enzyme GlgB (glgB), partial

Sign In for Pricing
View Details
ERC2 ORF Vector (Human) (pORF)
ORF012932 1.0 µg DNA

ERC2 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Cinp AAV siRNA Pooled Vector
16194166 1.0 µg

Cinp AAV siRNA Pooled Vector

Sign In for Pricing
View Details