Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OPTC Rabbit Polyclonal Antibody (HRP)

OPTC Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

OPT

UniProt

Q9UBM4

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human OPTC

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LSDNLLDSIPGPLPLSLRSVHLQNNLIETMQRDVFCDPEEHKHTRRQLED

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_055174

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Candida Albicans PHR2 Protein (aa 23-515)
VAng-Lsx05810-500gEcoli 500 µg (E. coli)

Recombinant Candida Albicans PHR2 Protein (aa 23-515)

Sign In for Pricing
View Details
Lentiviral mouse H3c11 shRNA (UAS) - Lentiviral mouse H3c11 shRNA (UAS, RFP) (100)
GTR15176244 1 Vial

Lentiviral mouse H3c11 shRNA (UAS) - Lentiviral mouse H3c11 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Rabbit Monoclonal CD25/IL-2R alpha Antibody (IL2RA/4375R) [DyLight 755]
NBP3-20703IR 0.1 mL

Rabbit Monoclonal CD25/IL-2R alpha Antibody (IL2RA/4375R) [DyLight 755]

Sign In for Pricing
View Details
Hamster Hantavirus (HV) ELISA Kit
SL0014Ha-01 48 Tests

Hamster Hantavirus (HV) ELISA Kit

Sign In for Pricing
View Details
Hamster Hantavirus (HV) ELISA Kit
SL0014Ha-02 96 Tests

Hamster Hantavirus (HV) ELISA Kit

Sign In for Pricing
View Details
PHF7 (PHD Finger Protein 7, DKFZp434L1850, HSPC045, HSPC226, MGC26088, NYD-SP6)
250057 50 µL

PHF7 (PHD Finger Protein 7, DKFZp434L1850, HSPC045, HSPC226, MGC26088, NYD-SP6)

Sign In for Pricing
View Details