Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RGD1564209 Rabbit Polyclonal Antibody (FITC)

RGD1564209 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat RGD1564209

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LFPVDVMRKAAQLGFGGIYVRTDVGGSGLSRLDTSVIFEALATGCTSTTA

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_001053896

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TTF-1 / NKX2.1 (8G7G3/1), CF405S conjugate, 0.1mg/mL
BNC040448-500 1x 500 µL

TTF-1 / NKX2.1 (8G7G3/1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NXPE2 (NM_182495) Human Over-expression Lysate
LC430590 20 µg

NXPE2 (NM_182495) Human Over-expression Lysate

Sign In for Pricing
View Details
UNC13A (NM_001080421) Human Over-expression Lysate
LY421638 100 µg

UNC13A (NM_001080421) Human Over-expression Lysate

Sign In for Pricing
View Details
Anti-Ubiquitin Antibody
KC-33336-01 50 μL

Anti-Ubiquitin Antibody

Sign In for Pricing
View Details
Anti-Ubiquitin Antibody
KC-33336-02 100 µL

Anti-Ubiquitin Antibody

Sign In for Pricing
View Details
Anti-Ubiquitin Antibody
KC-33336-03 1 mL

Anti-Ubiquitin Antibody

Sign In for Pricing
View Details