Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cpne7 Rabbit Polyclonal Antibody (HRP)

Cpne7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AW047065

UniProt

Q0VE82

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GARIPPKYEVSHDFAINFNPEDDECEGIQGVVEAYQNCLPKVQLYGPTNV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

61kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_733785

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cadmium Selenide Zinc Sulfide Quantum Dots 650nm - Alkyl
QD-650-A-5MG 5 mg

Cadmium Selenide Zinc Sulfide Quantum Dots 650nm - Alkyl

Sign In for Pricing
View Details
Anti-BRCC45/BRE Rabbit pAb
GB112384-50 50 μL

Anti-BRCC45/BRE Rabbit pAb

Sign In for Pricing
View Details
Gp100 (619-627) (acetate)
HY-P1796A 1 Each

Gp100 (619-627) (acetate)

Sign In for Pricing
View Details
Cpt1a Mouse Pre-designed siRNA Set A
HY-RS16248 1 Set

Cpt1a Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details
Lentiviral human PTX3 shRNA (UAS) - Lentiviral human PTX3 shRNA (UAS, iRFP) (100)
GTR15349326 1 Vial

Lentiviral human PTX3 shRNA (UAS) - Lentiviral human PTX3 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
EGFR, phosphorylated (Y1173) (Epidermal Growth Factor Receptor, EC=2.7.10.1, Proto-Oncogene c-ErbB-1, Receptor Tyrosine-Protein Kinase erbB-1, ERBB, ERBB1, HER1, EGFR) discontinued
222352-01 50 µL

EGFR, phosphorylated (Y1173) (Epidermal Growth Factor Receptor, EC=2.7.10.1, Proto-Oncogene c-ErbB-1, Receptor Tyrosine-Protein Kinase erbB-1, ERBB, ERBB1, HER1, EGFR) discontinued

Sign In for Pricing
View Details