Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sesn1 Rabbit Polyclonal Antibody (FITC)

Sesn1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

D3ZJU4

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: IWNYIHCMFGIRYDDYDYGEINQLLDRSFKVYIKTVVCTPEKVTKRMYDS

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001099866

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GLTPD2 (NM_001014985) Human Over-expression Lysate
LY423101 100 µg

GLTPD2 (NM_001014985) Human Over-expression Lysate

Sign In for Pricing
View Details
PTPN7 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3H8]
TA503662BM 100 µL

PTPN7 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3H8]

Sign In for Pricing
View Details
Mouse Adenylate Cyclase Activating Polypeptide 1, Pituitary (ADCYAP1) ELISA Kit
RDR-ADCYAP1-Mu-01 96 Tests

Mouse Adenylate Cyclase Activating Polypeptide 1, Pituitary (ADCYAP1) ELISA Kit

Sign In for Pricing
View Details
Mouse Adenylate Cyclase Activating Polypeptide 1, Pituitary (ADCYAP1) ELISA Kit
RDR-ADCYAP1-Mu-02 48 Tests

Mouse Adenylate Cyclase Activating Polypeptide 1, Pituitary (ADCYAP1) ELISA Kit

Sign In for Pricing
View Details
DHPS (NM_001930) Human Over-expression Lysate
LY400714 100 µg

DHPS (NM_001930) Human Over-expression Lysate

Sign In for Pricing
View Details
E2F4/E2F5 Rabbit Polyclonal Antibody
AP06091PU-N 100 µg

E2F4/E2F5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details