Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tinag Rabbit Polyclonal Antibody (FITC)

Tinag Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q66HF6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Rat Tinag

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SPPYRISSNETEIMREIIQNGPVQAIMQVHEDFFYYKTGIYRHVVSTNEE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001005549

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-PDGF Receptor beta (Tyr771) Polyclonal Antibody, APC Conjugated
bs-3303R-APC 100 µL

Phospho-PDGF Receptor beta (Tyr771) Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
TBCD antibody
70R-20716 50 μL

TBCD antibody

Sign In for Pricing
View Details
Rabbit Polyclonal JAM-4/IGSF5 Antibody [FITC]
NBP2-99581F 0.1 mL

Rabbit Polyclonal JAM-4/IGSF5 Antibody [FITC]

Sign In for Pricing
View Details
SATB1 (Special AT-rich Sequence Binding Protein 1, DNA Binding Protein SATB1) (MaxLight 750)
MBS6436735-01 0.1 mL

SATB1 (Special AT-rich Sequence Binding Protein 1, DNA Binding Protein SATB1) (MaxLight 750)

Sign In for Pricing
View Details
SATB1 (Special AT-rich Sequence Binding Protein 1, DNA Binding Protein SATB1) (MaxLight 750)
MBS6436735-02 5x 0.1 mL

SATB1 (Special AT-rich Sequence Binding Protein 1, DNA Binding Protein SATB1) (MaxLight 750)

Sign In for Pricing
View Details
LYN (N-Term) Rabbit pAb
MBS8556147-01 0.1 mL

LYN (N-Term) Rabbit pAb

Sign In for Pricing
View Details