Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tinag Rabbit Polyclonal Antibody (HRP)

Tinag Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q66HF6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Rat Tinag

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SPPYRISSNETEIMREIIQNGPVQAIMQVHEDFFYYKTGIYRHVVSTNEE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001005549

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

A630025C20RIK Rabbit Polyclonal Antibody (FITC)
orb2130391 100 µL

A630025C20RIK Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Guinea pig Interleukin 1beta converting enzyme (ICE) ELISA Kit
MBS261979-01 48 Well

Guinea pig Interleukin 1beta converting enzyme (ICE) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Interleukin 1beta converting enzyme (ICE) ELISA Kit
MBS261979-02 96 Well

Guinea pig Interleukin 1beta converting enzyme (ICE) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Interleukin 1beta converting enzyme (ICE) ELISA Kit
MBS261979-03 5x 96 Well

Guinea pig Interleukin 1beta converting enzyme (ICE) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Interleukin 1beta converting enzyme (ICE) ELISA Kit
MBS261979-04 10x 96 Well

Guinea pig Interleukin 1beta converting enzyme (ICE) ELISA Kit

Sign In for Pricing
View Details
RPS26P3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV784272 1.0 µg DNA

RPS26P3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details