Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DHDH Rabbit Polyclonal Antibody (FITC)

DHDH Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

2DD, HUM2DD

UniProt

Q9UQ10

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human DHDH

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PCWCPTELVVKGEHKEFPLPPVPKDCNFDNGAGMSYEAKHVWECLRKGMK

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Porcine, Yeast

Tested Applications

WB

NCBI Accession Number

NP_055290

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Erp44 Pre-designed siRNA Set A
SI104438A 1 Each

Mouse Erp44 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Ondansetron HCl
C07764-50mg 50 mg

Ondansetron HCl

Sign In for Pricing
View Details
RNF128 Rabbit Polyclonal Antibody (RBITC)
orb1035416 100 µL

RNF128 Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details
Anti-FOXP2 Antibody Picoband® (Dylight550 Conjugate)
A01329-1-Dylight550 100 µg

Anti-FOXP2 Antibody Picoband® (Dylight550 Conjugate)

Sign In for Pricing
View Details
ATF6 (Cyclic AMP-dependent Transcription Factor ATF-6 alpha, cAMP-dependent Transcription Factor ATF-6 alpha, Activating Transcription Factor 6 alpha, ATF6-alpha, Processed Cyclic AMP-dependent Transcription Factor ATF-6 alpha) (MaxLight 550)
123671-ML550 100 µL

ATF6 (Cyclic AMP-dependent Transcription Factor ATF-6 alpha, cAMP-dependent Transcription Factor ATF-6 alpha, Activating Transcription Factor 6 alpha, ATF6-alpha, Processed Cyclic AMP-dependent Transcription Factor ATF-6 alpha) (MaxLight 550)

Sign In for Pricing
View Details
CD46 (CD46 Antigen, CD46 Molecule, Antigen Identified by Monoclonal TRA-2-10, Complement Membrane Cofactor Protein, Measles Virus Receptor, Membrane Cofactor Protein Precursor, MCP, MGC26544, MIC10, TLX, TRA2.10, Trophoblast Leukocyte Common Antigen) (Biotin)
C2401-02G-Biotin 100 µL

CD46 (CD46 Antigen, CD46 Molecule, Antigen Identified by Monoclonal TRA-2-10, Complement Membrane Cofactor Protein, Measles Virus Receptor, Membrane Cofactor Protein Precursor, MCP, MGC26544, MIC10, TLX, TRA2.10, Trophoblast Leukocyte Common Antigen) (Biotin)

Sign In for Pricing
View Details