Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDLIM3 Rabbit Polyclonal Antibody (HRP)

PDLIM3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ALP

UniProt

Q53GG5

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PDLIM3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PQTVILPGPAPWGFRLSGGIDFNQPLVITRITPGSKAAAANLCPGDVILA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_055291

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human snRNA-activating protein complex subunit 1, SNAPC1 ELISA Kit
MBS9321666-01 48 Well

Human snRNA-activating protein complex subunit 1, SNAPC1 ELISA Kit

Sign In for Pricing
View Details
Human snRNA-activating protein complex subunit 1, SNAPC1 ELISA Kit
MBS9321666-02 96 Well

Human snRNA-activating protein complex subunit 1, SNAPC1 ELISA Kit

Sign In for Pricing
View Details
Human snRNA-activating protein complex subunit 1, SNAPC1 ELISA Kit
MBS9321666-03 5x 96 Well

Human snRNA-activating protein complex subunit 1, SNAPC1 ELISA Kit

Sign In for Pricing
View Details
Human snRNA-activating protein complex subunit 1, SNAPC1 ELISA Kit
MBS9321666-04 10x 96 Well

Human snRNA-activating protein complex subunit 1, SNAPC1 ELISA Kit

Sign In for Pricing
View Details
LIS1 (PAFAH1B1) (NM_000430) Human Over-expression Lysate
LS005048-100ug 100 µg

LIS1 (PAFAH1B1) (NM_000430) Human Over-expression Lysate

Sign In for Pricing
View Details
NBN Rabbit Polyclonal Antibody (BF680)
orb2463916 100 µL

NBN Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details