Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RABGEF1 Rabbit Polyclonal Antibody (FITC)

RABGEF1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

RAP1, RABEX5, rabex-5

UniProt

A8K3R3

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RABGEF1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MSLKSERRGIHVDQSDLLCKKGCGYYGNPAWQGFCSKCWREEYHKARQKQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_055319

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elongin A1 (Transcription Elongation Factor B Polypeptide 3, RNA Polymerase II Transcription Factor SIII Subunit A1, SIII p110, Elongin A, EloA, Elongin 110kD Subunit, TCEB3) discontinued
222407-01 50 µL

Elongin A1 (Transcription Elongation Factor B Polypeptide 3, RNA Polymerase II Transcription Factor SIII Subunit A1, SIII p110, Elongin A, EloA, Elongin 110kD Subunit, TCEB3) discontinued

Sign In for Pricing
View Details
Elongin A1 (Transcription Elongation Factor B Polypeptide 3, RNA Polymerase II Transcription Factor SIII Subunit A1, SIII p110, Elongin A, EloA, Elongin 110kD Subunit, TCEB3) discontinued
222407-02 100 µL

Elongin A1 (Transcription Elongation Factor B Polypeptide 3, RNA Polymerase II Transcription Factor SIII Subunit A1, SIII p110, Elongin A, EloA, Elongin 110kD Subunit, TCEB3) discontinued

Sign In for Pricing
View Details
AZD 5069
MBS3606371-01 2 mg

AZD 5069

Sign In for Pricing
View Details
AZD 5069
MBS3606371-02 5 mg

AZD 5069

Sign In for Pricing
View Details
AZD 5069
MBS3606371-03 10 mg

AZD 5069

Sign In for Pricing
View Details
AZD 5069
MBS3606371-04 25 mg

AZD 5069

Sign In for Pricing
View Details