Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PIK3R4 Rabbit Polyclonal Antibody (HRP)

PIK3R4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P150, VPS15

UniProt

Q99570

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PIK3R4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HDLPEKAEGEPKENGLVILVSVITSCLQTLKYCDSKLAALELILHLAPRL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

153kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_055417

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOLH1 Antibody
V8379-20UG 20 µg

FOLH1 Antibody

Sign In for Pricing
View Details
Rac3 Recombinant Antibody, PE-Cy5.5 Conjugated
bsm-62857R-PE-Cy5.5 100 µL

Rac3 Recombinant Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing
View Details
Chicken Acetylcholinesterase Associated Protein ELISA Kit
MBS086379 Inquire

Chicken Acetylcholinesterase Associated Protein ELISA Kit

Sign In for Pricing
View Details
Sheep Interleukin 17B ELISA Kit
MBS050683-01 48 Well

Sheep Interleukin 17B ELISA Kit

Sign In for Pricing
View Details
Sheep Interleukin 17B ELISA Kit
MBS050683-02 96 Well

Sheep Interleukin 17B ELISA Kit

Sign In for Pricing
View Details
Sheep Interleukin 17B ELISA Kit
MBS050683-03 5x 96 Well

Sheep Interleukin 17B ELISA Kit

Sign In for Pricing
View Details