Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Vwa5a Rabbit Polyclonal Antibody (HRP)

Vwa5a Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BCSC-, Loh11, BCSC-1, AW552491, Loh11cr2a, E130119J22, 5830475I06Rik

UniProt

Q99KC8

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VLSSFTAFIAINKELNKPVQGPLAHRVIPRPVMAGSSSMRFYSSFSGGFK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

87kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_766355

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DOG-1 (DG1/447), 0.2mg/mL
BNUB0447-100 1x 100 µL

DOG-1 (DG1/447), 0.2mg/mL

Sign In for Pricing
View Details
NUDT6 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI9D12]
TA502343AM 100 µL

NUDT6 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI9D12]

Sign In for Pricing
View Details
Cytokeratin 2e Recombinant Rabbit Monoclonal Antibody [JJ201-8]
ET1701-13 100 µL

Cytokeratin 2e Recombinant Rabbit Monoclonal Antibody [JJ201-8]

Sign In for Pricing
View Details
Lisadimate (>85%)
TRC-L460000-10MG 10 mg

Lisadimate (>85%)

Sign In for Pricing
View Details
MMACHC Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2A6]
TA504934AM 100 µL

MMACHC Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2A6]

Sign In for Pricing
View Details
PE Anti-Human CD27 Antibody[O323]
E-AB-F1140D-01 20 Tests

PE Anti-Human CD27 Antibody[O323]

Sign In for Pricing
View Details