Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VASH1 Rabbit Polyclonal Antibody (HRP)

VASH1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TTCP 1, KIAA1036

UniProt

Q7L8A9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human VASH1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SVPTFQPSTPVPERLEAVQRYIRELQYNHTGTQFFEIKKSRPLTGLMDLA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_055724

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRPL50 Rabbit Polyclonal Antibody (HRP)
orb2101841 100 µL

MRPL50 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
SLC52A2 (Solute Carrier Family 52, Riboflavin Transporter, Member 2)
492148 100 µL

SLC52A2 (Solute Carrier Family 52, Riboflavin Transporter, Member 2)

Sign In for Pricing
View Details
Indole-3-butyric acid
GK7772-25g 25 g

Indole-3-butyric acid

Sign In for Pricing
View Details
Mouse Microtubule-associated protein 4, MAP4 ELISA Kit
MBS9322704-01 48 Well

Mouse Microtubule-associated protein 4, MAP4 ELISA Kit

Sign In for Pricing
View Details
Mouse Microtubule-associated protein 4, MAP4 ELISA Kit
MBS9322704-02 96 Well

Mouse Microtubule-associated protein 4, MAP4 ELISA Kit

Sign In for Pricing
View Details
Mouse Microtubule-associated protein 4, MAP4 ELISA Kit
MBS9322704-03 5x 96 Well

Mouse Microtubule-associated protein 4, MAP4 ELISA Kit

Sign In for Pricing
View Details