Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CPEB3 Rabbit Polyclonal Antibody (HRP)

CPEB3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q8NE35

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CPEB3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RTDNGNNLLPFQDRSRPYDTFNLHSLENSLMDMIRTDHEPLKGKHYPPSG

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

76kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_055727

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse T-lymphoma invasion and metastasis-inducing protein 2 (Tiam2) , partial
MBS1472027 Inquire

Recombinant Mouse T-lymphoma invasion and metastasis-inducing protein 2 (Tiam2) , partial

Sign In for Pricing
View Details
Human Speckle-Type POZ Protein (SPOP) ELISA Kit
MBS9714006-01 48 Tests

Human Speckle-Type POZ Protein (SPOP) ELISA Kit

Sign In for Pricing
View Details
Human Speckle-Type POZ Protein (SPOP) ELISA Kit
MBS9714006-02 96 Tests

Human Speckle-Type POZ Protein (SPOP) ELISA Kit

Sign In for Pricing
View Details
Human Speckle-Type POZ Protein (SPOP) ELISA Kit
MBS9714006-03 5x 96 Tests

Human Speckle-Type POZ Protein (SPOP) ELISA Kit

Sign In for Pricing
View Details
PE Linked Polyclonal Antibody to Aquaporin 1 (AQP1)
MBS2130292-01 0.1 mL

PE Linked Polyclonal Antibody to Aquaporin 1 (AQP1)

Sign In for Pricing
View Details
PE Linked Polyclonal Antibody to Aquaporin 1 (AQP1)
MBS2130292-02 0.2 mL

PE Linked Polyclonal Antibody to Aquaporin 1 (AQP1)

Sign In for Pricing
View Details