Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

R3HDM2 Rabbit Polyclonal Antibody (HRP)

R3HDM2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CAG6, PR01365

UniProt

Q9Y2K5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human R3HDM2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QSTYTVHQGQSGLKHGNRGKRQALKSASTDLGTADVVLGRVLEVTDLPEG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

68kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_055740

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD99 (MIC2/877), CF568 conjugate, 0.1mg/mL
BNC680877-500 1x 500 µL

CD99 (MIC2/877), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Carbonic Anhydrase II/Car2 Monoclonal Antibody
AN300544P 100 µL

Recombinant Carbonic Anhydrase II/Car2 Monoclonal Antibody

Sign In for Pricing
View Details
Ionotropic Glutamate receptor 2 (GRIA2) Rabbit Monoclonal Antibody
TA423245 100 µL

Ionotropic Glutamate receptor 2 (GRIA2) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
CARM1 Recombinant Rabbit Monoclonal Antibody [PSH05-08]
HA722224 100 µL

CARM1 Recombinant Rabbit Monoclonal Antibody [PSH05-08]

Sign In for Pricing
View Details
Uncoated Human PINP (Procollagen I N-Terminal Propeptide) ELISA Kit
E-UNEL-H0062-01 5x 96 Tests

Uncoated Human PINP (Procollagen I N-Terminal Propeptide) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human PINP (Procollagen I N-Terminal Propeptide) ELISA Kit
E-UNEL-H0062-02 15x 96 Tests

Uncoated Human PINP (Procollagen I N-Terminal Propeptide) ELISA Kit

Sign In for Pricing
View Details