Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP6R1 Rabbit Polyclonal Antibody (HRP)

PPP6R1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PP6R1, SAPS1, SAP190, KIAA1115

UniProt

Q9UPN7

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PPP6R1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MFWKFDLHTSSHLDTLLEREDLSLPELLDEEDVLQECKVVNRKLLDFLLQ

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

97kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_055746

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NFKBIL1 Rabbit Polyclonal Antibody (PE)
orb492127 100 µL

NFKBIL1 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Mouse Monoclonal Lipocalin-2/NGAL Antibody (14) [mFluor Violet 610 SE]
NBP2-41364MFV610 0.1 mL

Mouse Monoclonal Lipocalin-2/NGAL Antibody (14) [mFluor Violet 610 SE]

Sign In for Pricing
View Details
Gm14446 Protein Vector (Mouse) (pPB-C-His)
PV183242 500 ng

Gm14446 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Recombinant Mouse CMA1/ Chymase 1 Protein, His, E.coli-10ug
QP5845-ec-10ug 10ug

Recombinant Mouse CMA1/ Chymase 1 Protein, His, E.coli-10ug

Sign In for Pricing
View Details
Coagulation Factor VIII B Polypeptide (F13B) Monkey ELISA Kit
D3370 96 Tests

Coagulation Factor VIII B Polypeptide (F13B) Monkey ELISA Kit

Sign In for Pricing
View Details
SOX9 / SRY-box 9 (SOX9/2387), CF488A conjugate, 0.1mg/mL
BNC882387-500 1x 500 µL

SOX9 / SRY-box 9 (SOX9/2387), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details