Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP6R1 Rabbit Polyclonal Antibody (HRP)

PPP6R1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PP6R1, SAPS1, SAP190, KIAA1115

UniProt

Q9UPN7

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PPP6R1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MFWKFDLHTSSHLDTLLEREDLSLPELLDEEDVLQECKVVNRKLLDFLLQ

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

97kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_055746

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea Pig chymotrypsin ELISA kit
GTR10464230 96 Well

Guinea Pig chymotrypsin ELISA kit

Sign In for Pricing
View Details
Recombinant Mycobacterium Abscessus hemL Protein (aa 1-446)
VAng-Yyj5436-1mgEcoli 1 mg (E. coli)

Recombinant Mycobacterium Abscessus hemL Protein (aa 1-446)

Sign In for Pricing
View Details
SFXN5 Rabbit pAb, PE-Cy7 conjugated
orb2861919 100 µL

SFXN5 Rabbit pAb, PE-Cy7 conjugated

Sign In for Pricing
View Details
Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) ASE1 Polyclonal Antibody
MBS9010078 Inquire

Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) ASE1 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant LIN28 Antibody
RC-16903-01 50 μL

Recombinant LIN28 Antibody

Sign In for Pricing
View Details
Recombinant LIN28 Antibody
RC-16903-02 100 µL

Recombinant LIN28 Antibody

Sign In for Pricing
View Details