Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sec31a Rabbit Polyclonal Antibody (HRP)

Sec31a Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

VAP1, Sec31l1

UniProt

Q9Z2Q1

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Rat

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DKEVVIAQKDKHTGPVRALDVNIFQTNLVASGANESEIYIWDLNNFATPM

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

136kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_148981

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human USP25 shRNA (UAS) - Lentiviral human USP25 shRNA (UAS, RFP) (100)
GTR15115464 1 Vial

Lentiviral human USP25 shRNA (UAS) - Lentiviral human USP25 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
HSP90AB1 Monoclonal Antibody
CSB-MA000289-01 50 µg

HSP90AB1 Monoclonal Antibody

Sign In for Pricing
View Details
HSP90AB1 Monoclonal Antibody
CSB-MA000289-02 100 µg

HSP90AB1 Monoclonal Antibody

Sign In for Pricing
View Details
TPSD1, CT (TPSD1, Tryptase delta, Delta-tryptase, HmMCP-3-like tryptase III, Mast cell mMCP-7-like, Tryptase-3) (MaxLight 490)
MBS6357753-01 0.1 mL

TPSD1, CT (TPSD1, Tryptase delta, Delta-tryptase, HmMCP-3-like tryptase III, Mast cell mMCP-7-like, Tryptase-3) (MaxLight 490)

Sign In for Pricing
View Details
TPSD1, CT (TPSD1, Tryptase delta, Delta-tryptase, HmMCP-3-like tryptase III, Mast cell mMCP-7-like, Tryptase-3) (MaxLight 490)
MBS6357753-02 5x 0.1 mL

TPSD1, CT (TPSD1, Tryptase delta, Delta-tryptase, HmMCP-3-like tryptase III, Mast cell mMCP-7-like, Tryptase-3) (MaxLight 490)

Sign In for Pricing
View Details
MYO9A siRNA (Human)
CRH3073-01 15 nmol

MYO9A siRNA (Human)

Sign In for Pricing
View Details