Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KHDC4 Rabbit Polyclonal Antibody (Biotin)

KHDC4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

BLOM7, KIAA0907, SNORA80EHG

UniProt

Q7Z7F0

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human K0907

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TRGQTQDEISRLSGAAVSTRGRFMTTEEKAKVGPGDRPLYLHVQGQTREL

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

67kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_055764

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SGCB Rabbit pAb
E45R26991N-100 100 µL

SGCB Rabbit pAb

Sign In for Pricing
View Details
KIT, ID (Y547) (KIT, SCFR, Mast/stem cell growth factor receptor Kit, Piebald trait protein, Proto-oncogene c-Kit, Tyrosine-protein kinase Kit, p145 c-kit, v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog, CD117) (MaxLight 650) discontinued
037489-ML650 100 µL

KIT, ID (Y547) (KIT, SCFR, Mast/stem cell growth factor receptor Kit, Piebald trait protein, Proto-oncogene c-Kit, Tyrosine-protein kinase Kit, p145 c-kit, v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog, CD117) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Heme Oxygenase 2 Lentiviral Activation Particles (h)
sc-402580-LAC 200 µL

Heme Oxygenase 2 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
MUC1/EMA, CT (MUC1, PUM, Mucin-1, Breast carcinoma-associated antigen DF3, Carcinoma-associated mucin, Episialin, H23AG, Krebs von den Lungen-6, PEMT, Peanut-reactive urinary mucin, Polymorphic epithelial mucin, Tumor-associated epithelial membrane antige
MBS6322917-01 0.1 mL

MUC1/EMA, CT (MUC1, PUM, Mucin-1, Breast carcinoma-associated antigen DF3, Carcinoma-associated mucin, Episialin, H23AG, Krebs von den Lungen-6, PEMT, Peanut-reactive urinary mucin, Polymorphic epithelial mucin, Tumor-associated epithelial membrane antige

Sign In for Pricing
View Details
MUC1/EMA, CT (MUC1, PUM, Mucin-1, Breast carcinoma-associated antigen DF3, Carcinoma-associated mucin, Episialin, H23AG, Krebs von den Lungen-6, PEMT, Peanut-reactive urinary mucin, Polymorphic epithelial mucin, Tumor-associated epithelial membrane antige
MBS6322917-02 5x 0.1 mL

MUC1/EMA, CT (MUC1, PUM, Mucin-1, Breast carcinoma-associated antigen DF3, Carcinoma-associated mucin, Episialin, H23AG, Krebs von den Lungen-6, PEMT, Peanut-reactive urinary mucin, Polymorphic epithelial mucin, Tumor-associated epithelial membrane antige

Sign In for Pricing
View Details
Recombinant Human BTD Protein, N-His
orb3061721-01 50 µg

Recombinant Human BTD Protein, N-His

Sign In for Pricing
View Details