Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KHDC4 Rabbit Polyclonal Antibody (HRP)

KHDC4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BLOM7, KIAA0907, SNORA80EHG

UniProt

Q7Z7F0

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human K0907

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TRGQTQDEISRLSGAAVSTRGRFMTTEEKAKVGPGDRPLYLHVQGQTREL

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

67kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_055764

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA Class 1 Antigen E (HLA Class I Histocompatibility Antigen alpha Chain E, HLAE, HLA-E, HLA-6.2, EA1.2, EA2.1, Major Histocompatibility Complex Class I E, MHC Class I Antigen E, QA1) (HRP)
MBS6381192-01 0.1 mL

HLA Class 1 Antigen E (HLA Class I Histocompatibility Antigen alpha Chain E, HLAE, HLA-E, HLA-6.2, EA1.2, EA2.1, Major Histocompatibility Complex Class I E, MHC Class I Antigen E, QA1) (HRP)

Sign In for Pricing
View Details
HLA Class 1 Antigen E (HLA Class I Histocompatibility Antigen alpha Chain E, HLAE, HLA-E, HLA-6.2, EA1.2, EA2.1, Major Histocompatibility Complex Class I E, MHC Class I Antigen E, QA1) (HRP)
MBS6381192-02 5x 0.1 mL

HLA Class 1 Antigen E (HLA Class I Histocompatibility Antigen alpha Chain E, HLAE, HLA-E, HLA-6.2, EA1.2, EA2.1, Major Histocompatibility Complex Class I E, MHC Class I Antigen E, QA1) (HRP)

Sign In for Pricing
View Details
PARP6, CT (PARP6, Poly [ADP-ribose] polymerase 6, ADP-ribosyltransferase diphtheria toxin-like 17) (Azide free) (HRP)
MBS6331004-01 0.2 mL

PARP6, CT (PARP6, Poly [ADP-ribose] polymerase 6, ADP-ribosyltransferase diphtheria toxin-like 17) (Azide free) (HRP)

Sign In for Pricing
View Details
PARP6, CT (PARP6, Poly [ADP-ribose] polymerase 6, ADP-ribosyltransferase diphtheria toxin-like 17) (Azide free) (HRP)
MBS6331004-02 5x 0.2 mL

PARP6, CT (PARP6, Poly [ADP-ribose] polymerase 6, ADP-ribosyltransferase diphtheria toxin-like 17) (Azide free) (HRP)

Sign In for Pricing
View Details
Fyn Polyclonal Antibody
RA25144-01 50 µL

Fyn Polyclonal Antibody

Sign In for Pricing
View Details
Fyn Polyclonal Antibody
RA25144-02 100 µL

Fyn Polyclonal Antibody

Sign In for Pricing
View Details