Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIFAP3 Rabbit Polyclonal Antibody (HRP)

KIFAP3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FLA3, KAP3, SMAP, KAP-1, KAP-3, Smg-GDS, dJ190I16.1

UniProt

Q92845

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human KIFAP3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: WLEMVESRQMDESEQYLYGDDRIEPYIHEGDILERPDLFYNSDGLIASEG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

91kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_055785

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CB083 rabbit pAb Antibody
orb2305939-01 50 µL

CB083 rabbit pAb Antibody

Sign In for Pricing
View Details
CB083 rabbit pAb Antibody
orb2305939-02 100 µL

CB083 rabbit pAb Antibody

Sign In for Pricing
View Details
Shc (phospho-Tyr317) rabbit pAb
E44H14571 100 µL

Shc (phospho-Tyr317) rabbit pAb

Sign In for Pricing
View Details
Recombinant Phosphoenolpyruvate carboxylase (ppc), partial
MBS1448299 Inquire

Recombinant Phosphoenolpyruvate carboxylase (ppc), partial

Sign In for Pricing
View Details
C1r siRNA Oligos set (Rat)
14261176 3x 5 nmol

C1r siRNA Oligos set (Rat)

Sign In for Pricing
View Details
Achaete scute homolog 3 (ASCL3) Human qPCR Primer Pair (NM_020646)
HP213734 200 Reactions

Achaete scute homolog 3 (ASCL3) Human qPCR Primer Pair (NM_020646)

Sign In for Pricing
View Details