Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIFAP3 Rabbit Polyclonal Antibody (HRP)

KIFAP3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FLA3, KAP3, SMAP, KAP-1, KAP-3, Smg-GDS, dJ190I16.1

UniProt

Q92845

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human KIFAP3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: WLEMVESRQMDESEQYLYGDDRIEPYIHEGDILERPDLFYNSDGLIASEG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

91kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_055785

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SH3BGRL3 AAV Vector (Rat) (CMV)
43665106 1 µg

SH3BGRL3 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
Recombinant Mouse Beta-enolase (Eno3)
RPC31120-01 20 µg

Recombinant Mouse Beta-enolase (Eno3)

Sign In for Pricing
View Details
Recombinant Mouse Beta-enolase (Eno3)
RPC31120-02 100 µg

Recombinant Mouse Beta-enolase (Eno3)

Sign In for Pricing
View Details
Recombinant Mouse Beta-enolase (Eno3)
RPC31120-03 1 mg

Recombinant Mouse Beta-enolase (Eno3)

Sign In for Pricing
View Details
GNAL (Guanine Nucleotide-Binding Protein G (olf) Subunit Alpha, Guanine Nucleotide Binding Protein (G Protein), Alpha Activating Activity Polypeptide, Olfactory Type)
481961 100 µL

GNAL (Guanine Nucleotide-Binding Protein G (olf) Subunit Alpha, Guanine Nucleotide Binding Protein (G Protein), Alpha Activating Activity Polypeptide, Olfactory Type)

Sign In for Pricing
View Details
Rabbit BPI (Bactericidal/Permeability Increasing Protein) ELISA Kit
MBS2503825-01 24 Tests

Rabbit BPI (Bactericidal/Permeability Increasing Protein) ELISA Kit

Sign In for Pricing
View Details