Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DAAM1 Rabbit Polyclonal Antibody (FITC)

DAAM1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

FLJ41657, KIAA0666

UniProt

Q9Y4D1

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human DAAM1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GNTVQYWLLLDRIIQQIVIQNDKGQDPDSTPLENFNIKNVVRMLVNENEV

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

123kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_055807

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Hmgcl shRNA (UAS) - Lentiviral mouse Hmgcl shRNA (UAS, RFP) plasmid
GTR15125929 1 Vial

Lentiviral mouse Hmgcl shRNA (UAS) - Lentiviral mouse Hmgcl shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
TAF4B, CT (TAF4B, TAF2C2, TAFII105, Transcription initiation factor TFIID subunit 4B, Transcription initiation factor TFIID 105kD subunit) (MaxLight 750)
MBS6353400-01 0.1 mL

TAF4B, CT (TAF4B, TAF2C2, TAFII105, Transcription initiation factor TFIID subunit 4B, Transcription initiation factor TFIID 105kD subunit) (MaxLight 750)

Sign In for Pricing
View Details
TAF4B, CT (TAF4B, TAF2C2, TAFII105, Transcription initiation factor TFIID subunit 4B, Transcription initiation factor TFIID 105kD subunit) (MaxLight 750)
MBS6353400-02 5x 0.1 mL

TAF4B, CT (TAF4B, TAF2C2, TAFII105, Transcription initiation factor TFIID subunit 4B, Transcription initiation factor TFIID 105kD subunit) (MaxLight 750)

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Human CD19 Antibody
JOT21613F 20Tests

PE/Cyanine7 Anti-Human CD19 Antibody

Sign In for Pricing
View Details
Bovine Spondin 1 ELISA Kit
MBS089084-01 48 Well

Bovine Spondin 1 ELISA Kit

Sign In for Pricing
View Details
Bovine Spondin 1 ELISA Kit
MBS089084-02 96 Well

Bovine Spondin 1 ELISA Kit

Sign In for Pricing
View Details