Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STK38L Rabbit Polyclonal Antibody (FITC)

STK38L Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

NDR2

UniProt

Q9Y2H1

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human STK38L

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PAAIPIEIKSIDDTSNFDDFPESDILQPVPNTTEPDYKSKDWVFLNYTYK

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_055815

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Copper (II) pyrophosphate
GX3834-1kg 1 Kg

Copper (II) pyrophosphate

Sign In for Pricing
View Details
Neuronal Cell Culture Medium A, w/o Glucose, Amino Acids, Sodium Pyruvate, Sodium Bicarbonate, HEPES, Phenol Red (Powder)
N1020-03-01 10 L

Neuronal Cell Culture Medium A, w/o Glucose, Amino Acids, Sodium Pyruvate, Sodium Bicarbonate, HEPES, Phenol Red (Powder)

Sign In for Pricing
View Details
Neuronal Cell Culture Medium A, w/o Glucose, Amino Acids, Sodium Pyruvate, Sodium Bicarbonate, HEPES, Phenol Red (Powder)
N1020-03-02 25 L

Neuronal Cell Culture Medium A, w/o Glucose, Amino Acids, Sodium Pyruvate, Sodium Bicarbonate, HEPES, Phenol Red (Powder)

Sign In for Pricing
View Details
Neuronal Cell Culture Medium A, w/o Glucose, Amino Acids, Sodium Pyruvate, Sodium Bicarbonate, HEPES, Phenol Red (Powder)
N1020-03-03 50 L

Neuronal Cell Culture Medium A, w/o Glucose, Amino Acids, Sodium Pyruvate, Sodium Bicarbonate, HEPES, Phenol Red (Powder)

Sign In for Pricing
View Details
Neuronal Cell Culture Medium A, w/o Glucose, Amino Acids, Sodium Pyruvate, Sodium Bicarbonate, HEPES, Phenol Red (Powder)
N1020-03-04 100 L

Neuronal Cell Culture Medium A, w/o Glucose, Amino Acids, Sodium Pyruvate, Sodium Bicarbonate, HEPES, Phenol Red (Powder)

Sign In for Pricing
View Details
Rabbit Polyclonal Proteasome beta 1 Antibody
NBP1-89714 0.1 mL

Rabbit Polyclonal Proteasome beta 1 Antibody

Sign In for Pricing
View Details