Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FTSJD2 Rabbit Polyclonal Antibody (HRP)

FTSJD2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MTr1, hMTr1, FTSJD2, KIAA0082

UniProt

Q8N1G2

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human FTSJD2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YRLEEMEKIFVRLEMKIIKGSSGTPKLSYTGRDDRHFVPMGLYIVRTVNE

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

95kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_055865

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABLIM2 Human Over-expression Lysate
orb1361251 20 µg

ABLIM2 Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Monoclonal Hepatitis C Virus Core Antigen Antibody (C7-50) [Allophycocyanin/Cy7]
NB120-2740APCCY7 0.1 mL

Mouse Monoclonal Hepatitis C Virus Core Antigen Antibody (C7-50) [Allophycocyanin/Cy7]

Sign In for Pricing
View Details
PepA Antibody
orb809107 2 mg

PepA Antibody

Sign In for Pricing
View Details
Senp1, ID (Senp1, Supr2, Sentrin-specific protease 1, SUMO-1 protease 2, Sentrin/SUMO-specific protease SENP1) (MaxLight 550) discontinued
041549-ML550 100 µL

Senp1, ID (Senp1, Supr2, Sentrin-specific protease 1, SUMO-1 protease 2, Sentrin/SUMO-specific protease SENP1) (MaxLight 550) discontinued

Sign In for Pricing
View Details
ARC Peptide
2081P 0.05 mg

ARC Peptide

Sign In for Pricing
View Details
TNNT2 Adenovirus (Rat)
47251056 1.0 mL

TNNT2 Adenovirus (Rat)

Sign In for Pricing
View Details