Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDK19 Rabbit Polyclonal Antibody (Biotin)

CDK19 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CDK11, DEE87, CDC2L6, EIEE87, bA346C16.3

UniProt

Q9BWU1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human CDK19

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LLTMDPTKRITSEQALQDPYFQEDPLPTLDVFAGCQIPYPKREFLNEDDP

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal Antibody to GA Binding Protein Transcription Factor Alpha (GABPa)
TRV-0060083-01 20 µL

Monoclonal Antibody to GA Binding Protein Transcription Factor Alpha (GABPa)

Sign In for Pricing
View Details
Monoclonal Antibody to GA Binding Protein Transcription Factor Alpha (GABPa)
TRV-0060083-02 100 µL

Monoclonal Antibody to GA Binding Protein Transcription Factor Alpha (GABPa)

Sign In for Pricing
View Details
Monoclonal Antibody to GA Binding Protein Transcription Factor Alpha (GABPa)
TRV-0060083-03 200 µL

Monoclonal Antibody to GA Binding Protein Transcription Factor Alpha (GABPa)

Sign In for Pricing
View Details
Monoclonal Antibody to GA Binding Protein Transcription Factor Alpha (GABPa)
TRV-0060083-04 1 mL

Monoclonal Antibody to GA Binding Protein Transcription Factor Alpha (GABPa)

Sign In for Pricing
View Details
2- (4- ((4-Methylpyridin-2-yl) oxy) phenyl) acetic acid
GCA30860-01 100 mg

2- (4- ((4-Methylpyridin-2-yl) oxy) phenyl) acetic acid

Sign In for Pricing
View Details
2- (4- ((4-Methylpyridin-2-yl) oxy) phenyl) acetic acid
GCA30860-02 1 g

2- (4- ((4-Methylpyridin-2-yl) oxy) phenyl) acetic acid

Sign In for Pricing
View Details