Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPART Rabbit Polyclonal Antibody (HRP)

SPART Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SPG20, TAHCCP1

UniProt

Q8N0X7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SPG20

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ASWVSWGLVKGAEITGKAIQKGASKLRERIQPEEKPVEVSPAVTKGLYIA

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

73kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_055902

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine T-complex protein 1 subunit zeta, CCT6A ELISA Kit
MBS9319491-01 48 Well

Bovine T-complex protein 1 subunit zeta, CCT6A ELISA Kit

Sign In for Pricing
View Details
Bovine T-complex protein 1 subunit zeta, CCT6A ELISA Kit
MBS9319491-02 96 Well

Bovine T-complex protein 1 subunit zeta, CCT6A ELISA Kit

Sign In for Pricing
View Details
Bovine T-complex protein 1 subunit zeta, CCT6A ELISA Kit
MBS9319491-03 5x 96 Well

Bovine T-complex protein 1 subunit zeta, CCT6A ELISA Kit

Sign In for Pricing
View Details
Bovine T-complex protein 1 subunit zeta, CCT6A ELISA Kit
MBS9319491-04 10x 96 Well

Bovine T-complex protein 1 subunit zeta, CCT6A ELISA Kit

Sign In for Pricing
View Details
PREP discontinued
393333 200 µL

PREP discontinued

Sign In for Pricing
View Details
Canine HLA-B Associated Transcript 3 ELISA Kit
MBS073588-01 48 Well

Canine HLA-B Associated Transcript 3 ELISA Kit

Sign In for Pricing
View Details