Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIAA0692 Rabbit Polyclonal Antibody (Biotin)

KIAA0692 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Lem4, LEMD7, MCPH16, KIAA0692

UniProt

Q86XL3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human KIAA0692

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: CYSPSDRQSWPSPAVKGRFKSQLPDLSGPHSYSPGRNSVAGSNPAKPGLG

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

104kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_055929

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Camel Transient Receptor Potential Cation Channel Subfamily M, Member 4 ELISA Kit
MBS066441-01 48 Well

Camel Transient Receptor Potential Cation Channel Subfamily M, Member 4 ELISA Kit

Sign In for Pricing
View Details
Camel Transient Receptor Potential Cation Channel Subfamily M, Member 4 ELISA Kit
MBS066441-02 96 Well

Camel Transient Receptor Potential Cation Channel Subfamily M, Member 4 ELISA Kit

Sign In for Pricing
View Details
Camel Transient Receptor Potential Cation Channel Subfamily M, Member 4 ELISA Kit
MBS066441-03 5x 96 Well

Camel Transient Receptor Potential Cation Channel Subfamily M, Member 4 ELISA Kit

Sign In for Pricing
View Details
Camel Transient Receptor Potential Cation Channel Subfamily M, Member 4 ELISA Kit
MBS066441-04 10x 96 Well

Camel Transient Receptor Potential Cation Channel Subfamily M, Member 4 ELISA Kit

Sign In for Pricing
View Details
Map2k5 Antibody
MBS7130481-01 0.1 mL

Map2k5 Antibody

Sign In for Pricing
View Details
Map2k5 Antibody
MBS7130481-02 5x 0.1 mL

Map2k5 Antibody

Sign In for Pricing
View Details