Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Agtpbp1 Rabbit Polyclonal Antibody (HRP)

Agtpbp1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

N, at, Ccp, pcd, CCP1, Nna1, atms, nmf243, 1700020N17Rik, 2310001G17Rik, 2900054O13Rik, 4930445M19Rik, 5730402G09Rik

UniProt

Q9UPW5, Q641K1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Agtpbp1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GMQPLMYSVQEALNARPWWIRMGTDICYYKNHFSRSSVAAGGQKGKSYYT

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

128kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_075817

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TL1A (TNFSF15) (Center) Rabbit Polyclonal Antibody
AP54314PU-N 400 µL

TL1A (TNFSF15) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Candidatus Liberibacter solanacearum TaqMan PCR Kit
TM66250 100 Reactions

Candidatus Liberibacter solanacearum TaqMan PCR Kit

Sign In for Pricing
View Details
MMP16 (C-term) Rabbit Polyclonal Antibody
AP23329PU-N 100 µg

MMP16 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ENTPD3 (NM_001248) Human Recombinant Protein
TP312912L 1 mg

ENTPD3 (NM_001248) Human Recombinant Protein

Sign In for Pricing
View Details
Copper Microplate Assay Kit
RDSM143 100 Assays

Copper Microplate Assay Kit

Sign In for Pricing
View Details
Malignant T cell amplified sequence 1 (MCTS1) Human Gene Knockout Kit (CRISPR)
KN400224 1 Kit

Malignant T cell amplified sequence 1 (MCTS1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details