Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIAA0930 Rabbit Polyclonal Antibody (Biotin)

KIAA0930 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

LSC3, C22orf9

UniProt

Q6ICG6

Immunogen

The immunogen for Anti-KIAA0930 antibody is: synthetic peptide directed towards the C-terminal region of Human K0930

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PSLKRKVPRNRIAEMKKSHSANDSEEFFREDDGGADLHNATNLRSRSLSG

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

40 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SAMD12 (A-6) Alexa Fluor® 546
sc-377123 AF546 200 µg/mL

SAMD12 (A-6) Alexa Fluor® 546

Sign In for Pricing
View Details
Ifngr1 Rabbit Polyclonal Antibody
orb1819472 100 µg

Ifngr1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ELISA kit for Human PRSS1 (Protease, Serine, 1)
E-EL-H1196 96 Tests

ELISA kit for Human PRSS1 (Protease, Serine, 1)

Sign In for Pricing
View Details
Rat Interleukin 2 Receptor Alpha (IL2Ra) ELISA Kit
201-11-1583 96 Tests

Rat Interleukin 2 Receptor Alpha (IL2Ra) ELISA Kit

Sign In for Pricing
View Details
AP-2 Colorimetric Cell-Based ELISA Kit
EKC1032 1 Kit, containing one 96 Well Plate and all necessary reagents

AP-2 Colorimetric Cell-Based ELISA Kit

Sign In for Pricing
View Details
DGCR6L CRISPR All-in-one AAV vector set (with saCas9)(Human)
18150151 3x 1.0 µg DNA

DGCR6L CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details