Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIAA0930 Rabbit Polyclonal Antibody (HRP)

KIAA0930 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LSC3, C22orf9

UniProt

Q6ICG6

Immunogen

The immunogen for Anti-KIAA0930 antibody is: synthetic peptide directed towards the C-terminal region of Human K0930

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PSLKRKVPRNRIAEMKKSHSANDSEEFFREDDGGADLHNATNLRSRSLSG

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CAD Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI10A3]
TA812683BM 100 µL

CAD Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI10A3]

Sign In for Pricing
View Details
C1QTNF1 Antibody
KC-1913-01 50 μL

C1QTNF1 Antibody

Sign In for Pricing
View Details
C1QTNF1 Antibody
KC-1913-02 100 µL

C1QTNF1 Antibody

Sign In for Pricing
View Details
C1QTNF1 Antibody
KC-1913-03 1 mL

C1QTNF1 Antibody

Sign In for Pricing
View Details
Human ARSI activation kit by CRISPRa
GA117458 1 Kit

Human ARSI activation kit by CRISPRa

Sign In for Pricing
View Details
(±)-Fluazifop
TRC-F407430-25MG 25 mg

(±)-Fluazifop

Sign In for Pricing
View Details