Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIAA0892 Rabbit Polyclonal Antibody (HRP)

KIAA0892 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SCC4, MAU2L, mau-2, KIAA0892

UniProt

Q9Y6X3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human KIAA0892

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MHQNFSQQLLQDHIEACSLPEHNLITWTDGPPPVQFQAQNGPNTSLASLL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

69kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_056144

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LFABP/FABP-1 Recombinant Antibody, AbBy Fluor™ 405 Conjugated
bsm-61432R-BF405-TR 20 µL

LFABP/FABP-1 Recombinant Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
UCK Antibody
orb1324485 100 µL

UCK Antibody

Sign In for Pricing
View Details
EIF3H Blocking Peptide
33R-5201 100 ug

EIF3H Blocking Peptide

Sign In for Pricing
View Details
ASXL1 Overexpression Lysate (Native) - (Dry Ice)
NBP2-07185 0.1 mg

ASXL1 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
Mouse Fibroblast Growth Factor 2, Basic (FGF2) ELISA Kit
RD-FGF2-Mu-48Tests 48 Tests

Mouse Fibroblast Growth Factor 2, Basic (FGF2) ELISA Kit

Sign In for Pricing
View Details
GMPPA Human shRNA Plasmid Kit (Locus ID 29926)
TL304303 1 Kit

GMPPA Human shRNA Plasmid Kit (Locus ID 29926)

Sign In for Pricing
View Details