Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPWD1 Rabbit Polyclonal Antibody (HRP)

PPWD1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

KIAA0073

UniProt

Q96BP3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PPWD1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FMIQTGDPTGTGMGGESIWGGEFEDEFHSTLRHDRPYTLSMANAGSNTNG

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

73kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_056157

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Angiopoietin Like Protein 4 (ANGPTL4) ELISA Kit
MBS457622-01 48 Tests

Human Angiopoietin Like Protein 4 (ANGPTL4) ELISA Kit

Sign In for Pricing
View Details
Human Angiopoietin Like Protein 4 (ANGPTL4) ELISA Kit
MBS457622-02 96 Tests

Human Angiopoietin Like Protein 4 (ANGPTL4) ELISA Kit

Sign In for Pricing
View Details
Human Angiopoietin Like Protein 4 (ANGPTL4) ELISA Kit
MBS457622-03 5x 96 Tests

Human Angiopoietin Like Protein 4 (ANGPTL4) ELISA Kit

Sign In for Pricing
View Details
Human Angiopoietin Like Protein 4 (ANGPTL4) ELISA Kit
MBS457622-04 10x 96 Tests

Human Angiopoietin Like Protein 4 (ANGPTL4) ELISA Kit

Sign In for Pricing
View Details
Monoclonal Antibody to Matrix Metalloproteinase 12 (MMP12)
TRV-0033554-01 20 µL

Monoclonal Antibody to Matrix Metalloproteinase 12 (MMP12)

Sign In for Pricing
View Details
Monoclonal Antibody to Matrix Metalloproteinase 12 (MMP12)
TRV-0033554-02 100 µL

Monoclonal Antibody to Matrix Metalloproteinase 12 (MMP12)

Sign In for Pricing
View Details