Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COG4 Rabbit Polyclonal Antibody (HRP)

COG4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

COD1, CDG2J, SWILS

UniProt

Q9H9E3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human COG4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TSLVAVELEKVVLKSTFNRLGGLQFDKELRSLIAYLTTVTTWTIRDKFAR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

89kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_056201

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAO Kinase 1 (Thousand and One Amino Acid Protein Kinase 1, TAOK1, hTAOK1, TAO1, Kinase from Chicken Homolog B, KFC-B, hKFC-B, KIAA1361, MAP3K16, MARK Kinase, MARKK, Prostate-derived Sterile 20-like Kinase 2, Prostate-derived STE20-like Kinase 2, PSK2, PSK-2, Serine/threonine-protein Kinase TAO1)
T0649-90D 50 µg

TAO Kinase 1 (Thousand and One Amino Acid Protein Kinase 1, TAOK1, hTAOK1, TAO1, Kinase from Chicken Homolog B, KFC-B, hKFC-B, KIAA1361, MAP3K16, MARK Kinase, MARKK, Prostate-derived Sterile 20-like Kinase 2, Prostate-derived STE20-like Kinase 2, PSK2, PSK-2, Serine/threonine-protein Kinase TAO1)

Sign In for Pricing
View Details
Anti-NHERF-2/SIP-1/SLC9A3R2 Antibody Picoband®, Cy3 Conjugate
A05624-2-Cy3 100 µg/Vial

Anti-NHERF-2/SIP-1/SLC9A3R2 Antibody Picoband®, Cy3 Conjugate

Sign In for Pricing
View Details
Anserini CD44 ELISA Kit
EAC0725 96 Tests

Anserini CD44 ELISA Kit

Sign In for Pricing
View Details
Monoclonal ENC1 Antibody (monoclonal) (M03), Clone: 3C10
APR11826G 0.1mg

Monoclonal ENC1 Antibody (monoclonal) (M03), Clone: 3C10

Sign In for Pricing
View Details
CALB1-set siRNA/shRNA/RNAi Lentivector (Human)
14919091 4x 500 ng

CALB1-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Cytomegalovirus Glycoprotein B, Late Cytoplasmic Antigen (CMVgB, CMV Glycoprotein GP55, HCMV, Human Herpes virus 5, HHV-5, HHV5, UL55) (MaxLight 405)
MBS6252763-01 0.1 mL

Cytomegalovirus Glycoprotein B, Late Cytoplasmic Antigen (CMVgB, CMV Glycoprotein GP55, HCMV, Human Herpes virus 5, HHV-5, HHV5, UL55) (MaxLight 405)

Sign In for Pricing
View Details