Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Poc1a Rabbit Polyclonal Antibody (Biotin)

Poc1a Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Wdr51a, RGD1565004

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Poc1a

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SRTGEYFASGGSDEQVMVWKSNFDTVDYGDMKARRPPPQASSAGTPPEMD

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001102766

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SERPINF1/PEDF/Serpin F1 Antibody
ANT-36339-100ug 100 µg

Human SERPINF1/PEDF/Serpin F1 Antibody

Sign In for Pricing
View Details
Lentiviral human SLC39A5 shRNA (UAS) - Lentiviral human SLC39A5 shRNA (UAS, RFP) (25)
GTR15084851 1 Vial

Lentiviral human SLC39A5 shRNA (UAS) - Lentiviral human SLC39A5 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
SLC39A11 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-9635R-BF488 100 µL

SLC39A11 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
Horse Anti-Mouse IgG (H&L) Antibody (Polyclonal IgG) - Texas Red
20308080-1 1 mg

Horse Anti-Mouse IgG (H&L) Antibody (Polyclonal IgG) - Texas Red

Sign In for Pricing
View Details
p53 (TP53) (NM_001126117) Human Tagged ORF Clone
RG225256 10 µg

p53 (TP53) (NM_001126117) Human Tagged ORF Clone

Sign In for Pricing
View Details
Sofosbuvir impurity C
T12958-01 100 mg

Sofosbuvir impurity C

Sign In for Pricing
View Details