Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Poc1a Rabbit Polyclonal Antibody (Biotin)

Poc1a Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Wdr51a, RGD1565004

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Poc1a

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SRTGEYFASGGSDEQVMVWKSNFDTVDYGDMKARRPPPQASSAGTPPEMD

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001102766

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Pde6b shRNA (UAS) - Lentiviral mouse Pde6b shRNA (UAS, iRFP) plasmid
GTR15169780 1 Vial

Lentiviral mouse Pde6b shRNA (UAS) - Lentiviral mouse Pde6b shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Recombinant Human Receptor-type tyrosine-protein phosphatase N2 (PTPRN2), partial
CSB-YP852923HU-01 20 µg

Recombinant Human Receptor-type tyrosine-protein phosphatase N2 (PTPRN2), partial

Sign In for Pricing
View Details
Recombinant Human Receptor-type tyrosine-protein phosphatase N2 (PTPRN2), partial
CSB-YP852923HU-02 100 µg

Recombinant Human Receptor-type tyrosine-protein phosphatase N2 (PTPRN2), partial

Sign In for Pricing
View Details
Recombinant Human Receptor-type tyrosine-protein phosphatase N2 (PTPRN2), partial
CSB-YP852923HU-03 1 mg

Recombinant Human Receptor-type tyrosine-protein phosphatase N2 (PTPRN2), partial

Sign In for Pricing
View Details
Rabbit NADH-cytochrome b5 reductase 3 (CYB5R3) ELISA Kit
MBS7252201-01 48 Well

Rabbit NADH-cytochrome b5 reductase 3 (CYB5R3) ELISA Kit

Sign In for Pricing
View Details
Rabbit NADH-cytochrome b5 reductase 3 (CYB5R3) ELISA Kit
MBS7252201-02 96 Well

Rabbit NADH-cytochrome b5 reductase 3 (CYB5R3) ELISA Kit

Sign In for Pricing
View Details