Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Poc1a Rabbit Polyclonal Antibody (FITC)

Poc1a Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Wdr51a, RGD1565004

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Poc1a

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SRTGEYFASGGSDEQVMVWKSNFDTVDYGDMKARRPPPQASSAGTPPEMD

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001102766

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal [clone 1B11] (IgG2a,k) to Human HMG1 / HMGB1
MBS245591-01 0.05 mg

Mouse Monoclonal [clone 1B11] (IgG2a,k) to Human HMG1 / HMGB1

Sign In for Pricing
View Details
Mouse Monoclonal [clone 1B11] (IgG2a,k) to Human HMG1 / HMGB1
MBS245591-02 5x 0.0 5mg

Mouse Monoclonal [clone 1B11] (IgG2a,k) to Human HMG1 / HMGB1

Sign In for Pricing
View Details
Rabbit Polyclonal SUPT5H Antibody [Alexa Fluor 488]
NB110-40593AF488 0.1 mL

Rabbit Polyclonal SUPT5H Antibody [Alexa Fluor 488]

Sign In for Pricing
View Details
Recombinant Human M-CSF/ CSF-1 Protein, His, Yeast-10ug
QP9081-ye-10ug 10ug

Recombinant Human M-CSF/ CSF-1 Protein, His, Yeast-10ug

Sign In for Pricing
View Details
HMGB1 Antibody Blocking peptide
orb1457123 500 µg

HMGB1 Antibody Blocking peptide

Sign In for Pricing
View Details
HIF-C2 25mg
A12921-25 25 mg

HIF-C2 25mg

Sign In for Pricing
View Details