Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Poc1a Rabbit Polyclonal Antibody (HRP)

Poc1a Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Wdr51a, RGD1565004

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Poc1a

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SRTGEYFASGGSDEQVMVWKSNFDTVDYGDMKARRPPPQASSAGTPPEMD

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001102766

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

L-Aspartic aicd sodium
M33621-01 200 mg

L-Aspartic aicd sodium

Sign In for Pricing
View Details
L-Aspartic aicd sodium
M33621-02 500 mg

L-Aspartic aicd sodium

Sign In for Pricing
View Details
L-Aspartic aicd sodium
M33621-03 1 g

L-Aspartic aicd sodium

Sign In for Pricing
View Details
POLE4 Antibody : Biotin (OAAF03576-Biotin)
OAAF03576-100UG-Biotin 100 µg

POLE4 Antibody : Biotin (OAAF03576-Biotin)

Sign In for Pricing
View Details
METTL1 Rabbit Polyclonal Antibody
orb580479 100 µL

METTL1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral human OPALIN shRNA (UAS) - Lentiviral human OPALIN shRNA (UAS, RFP) (100)
GTR15162228 1 Vial

Lentiviral human OPALIN shRNA (UAS) - Lentiviral human OPALIN shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details