Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIAA1267 Rabbit Polyclonal Antibody (Biotin)

KIAA1267 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

KDVS, NSL1, MSL1v1, CENP-36, hMSL1v1, KIAA1267

UniProt

Q7Z3B3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QPVLEFSLENLRTMNTSGQTALPQAPVNGLAKKLTKSSTHSDHDNSTSLN

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

121kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_056258

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hepatocyte Specific (OCH1E5), CF405S conjugate, 0.1mg/mL
BNC040671-500 1x 500 µL

Hepatocyte Specific (OCH1E5), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP40, YDJ1 Antibody: PerCP
SMC-166D-PCP 100 µg

HSP40, YDJ1 Antibody: PerCP

Sign In for Pricing
View Details
CD43 (T-Cell Marker) (rSPN/839), CF740 conjugate, 0.1mg/mL
BNC742220-500 1x 500 µL

CD43 (T-Cell Marker) (rSPN/839), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD40 / TNFRSF5 / CD40L-Receptor (C40/2383), 1mg/mL
BNUM2383-50 1x 50 µL

CD40 / TNFRSF5 / CD40L-Receptor (C40/2383), 1mg/mL

Sign In for Pricing
View Details
GnRH-Receptor (LHRH Receptor) (F1G4), CF594 conjugate, 0.1mg/mL
BNC940767-500 1x 500 µL

GnRH-Receptor (LHRH Receptor) (F1G4), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SARS-CoV-2 Spike Trimer Protein, His Tag (BA.2.38/Omicron) (MALS verified)
SPN-C522g-50ug 50 µg

SARS-CoV-2 Spike Trimer Protein, His Tag (BA.2.38/Omicron) (MALS verified)

Sign In for Pricing
View Details