Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIAA1267 Rabbit Polyclonal Antibody (FITC)

KIAA1267 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

KDVS, NSL1, MSL1v1, CENP-36, hMSL1v1, KIAA1267

UniProt

Q7Z3B3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QPVLEFSLENLRTMNTSGQTALPQAPVNGLAKKLTKSSTHSDHDNSTSLN

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

121kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_056258

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IgM Immunoglobulin (Cocktail), Biotin conjugate, 0.1mg/mL
BNCB0762-100 1x 100 µL

IgM Immunoglobulin (Cocktail), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Uridine 5'-Triphosphate TRIS Salt
TRC-U830043-50MG 50 mg

Uridine 5'-Triphosphate TRIS Salt

Sign In for Pricing
View Details
BRAT1 Recombinant Rabbit Monoclonal Antibody [JE64-71]
HA721091 100 µL

BRAT1 Recombinant Rabbit Monoclonal Antibody [JE64-71]

Sign In for Pricing
View Details
Pure Homarus americanus Lectin (California lobster) -HMA-
L-6201-1 1 mg

Pure Homarus americanus Lectin (California lobster) -HMA-

Sign In for Pricing
View Details
Tissue Total RNA, Lung: left lower lobe
CR562599 5 µg

Tissue Total RNA, Lung: left lower lobe

Sign In for Pricing
View Details
Recombinant Mouse Interleukin-2/IL-2 Protein
PKSM040308-01 20 µg

Recombinant Mouse Interleukin-2/IL-2 Protein

Sign In for Pricing
View Details