Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIAA1267 Rabbit Polyclonal Antibody (HRP)

KIAA1267 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

KDVS, NSL1, MSL1v1, CENP-36, hMSL1v1, KIAA1267

UniProt

Q7Z3B3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QPVLEFSLENLRTMNTSGQTALPQAPVNGLAKKLTKSSTHSDHDNSTSLN

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

121kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_056258

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TBS Buffer 20X with 2% Tween 20
42020413-1 500 mL

TBS Buffer 20X with 2% Tween 20

Sign In for Pricing
View Details
mmu-miR-302a miRNA Antagomir
MNM01649 2x 5.0 nmol

mmu-miR-302a miRNA Antagomir

Sign In for Pricing
View Details
BFSP2 (NM_003571) Human Over-expression Lysate
LS008419-100ug 100 µg

BFSP2 (NM_003571) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Sprouty Related, EVH1 Domain Containing Protein 2 (SPRED2) Protein
abx166216-01 10 µg

Human Sprouty Related, EVH1 Domain Containing Protein 2 (SPRED2) Protein

Sign In for Pricing
View Details
Human Sprouty Related, EVH1 Domain Containing Protein 2 (SPRED2) Protein
abx166216-02 50 µg

Human Sprouty Related, EVH1 Domain Containing Protein 2 (SPRED2) Protein

Sign In for Pricing
View Details
Human Sprouty Related, EVH1 Domain Containing Protein 2 (SPRED2) Protein
abx166216-03 100 µg

Human Sprouty Related, EVH1 Domain Containing Protein 2 (SPRED2) Protein

Sign In for Pricing
View Details