Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIAA1267 Rabbit Polyclonal Antibody (HRP)

KIAA1267 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

KDVS, NSL1, MSL1v1, CENP-36, hMSL1v1, KIAA1267

UniProt

Q7Z3B3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QPVLEFSLENLRTMNTSGQTALPQAPVNGLAKKLTKSSTHSDHDNSTSLN

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

121kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_056258

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Caspase-7 Rabbit pAb
E45R21796N-50 50 µL

Caspase-7 Rabbit pAb

Sign In for Pricing
View Details
FLAG Tag-Fusion Protein, Recombinant, Control for ELISA and Western Blot discontinued
208899 25 µg

FLAG Tag-Fusion Protein, Recombinant, Control for ELISA and Western Blot discontinued

Sign In for Pricing
View Details
CCDC28A shRNA Plasmid (m)
sc-142099-SH 20 µg

CCDC28A shRNA Plasmid (m)

Sign In for Pricing
View Details
DMWD Peptide - C-terminal region
MBS3240648-01 0.1 mg

DMWD Peptide - C-terminal region

Sign In for Pricing
View Details
DMWD Peptide - C-terminal region
MBS3240648-02 5x 0.1 mg

DMWD Peptide - C-terminal region

Sign In for Pricing
View Details
3-{[2- (Propan-2-yloxy) ethoxy]methyl}aniline
RQB71152-01 250 mg

3-{[2- (Propan-2-yloxy) ethoxy]methyl}aniline

Sign In for Pricing
View Details