Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RP11-529I10.4 Rabbit Polyclonal Antibody (Biotin)

RP11-529I10.4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

DKFZP566F084, RP11-529I10.4

UniProt

Q9BVM2

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RP11-529I10.4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MAEEYDEKTSELLVRKWRVKSALGAMGQWQLEVGDPAPLGAGNLGPELIK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_056263

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Tumor Necrosis Factor Receptor Superfamily Member 6 (FAS), C-His
AP2C799-01 1 mg

Recombinant Mouse Tumor Necrosis Factor Receptor Superfamily Member 6 (FAS), C-His

Sign In for Pricing
View Details
Recombinant Mouse Tumor Necrosis Factor Receptor Superfamily Member 6 (FAS), C-His
AP2C799-02 10 µg

Recombinant Mouse Tumor Necrosis Factor Receptor Superfamily Member 6 (FAS), C-His

Sign In for Pricing
View Details
Recombinant Mouse Tumor Necrosis Factor Receptor Superfamily Member 6 (FAS), C-His
AP2C799-03 50 µg

Recombinant Mouse Tumor Necrosis Factor Receptor Superfamily Member 6 (FAS), C-His

Sign In for Pricing
View Details
Recombinant Mouse Tumor Necrosis Factor Receptor Superfamily Member 6 (FAS), C-His
AP2C799-04 500 µg

Recombinant Mouse Tumor Necrosis Factor Receptor Superfamily Member 6 (FAS), C-His

Sign In for Pricing
View Details
SERPINB3 siRNA (Human)
MBS8239497-01 15 nmol

SERPINB3 siRNA (Human)

Sign In for Pricing
View Details
SERPINB3 siRNA (Human)
MBS8239497-02 30 nmol

SERPINB3 siRNA (Human)

Sign In for Pricing
View Details