Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RP11-529I10.4 Rabbit Polyclonal Antibody (HRP)

RP11-529I10.4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DKFZP566F084, RP11-529I10.4

UniProt

Q9BVM2

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RP11-529I10.4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MAEEYDEKTSELLVRKWRVKSALGAMGQWQLEVGDPAPLGAGNLGPELIK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_056263

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TLR9 (Toll-Like Receptor 9) CLIA Kit
E-CL-H0648-01 24 Tests

Human TLR9 (Toll-Like Receptor 9) CLIA Kit

Sign In for Pricing
View Details
Human TLR9 (Toll-Like Receptor 9) CLIA Kit
E-CL-H0648-02 48 Tests

Human TLR9 (Toll-Like Receptor 9) CLIA Kit

Sign In for Pricing
View Details
Human TLR9 (Toll-Like Receptor 9) CLIA Kit
E-CL-H0648-03 96 Tests

Human TLR9 (Toll-Like Receptor 9) CLIA Kit

Sign In for Pricing
View Details
CHADL Rabbit Polyclonal Antibody
TA372230 100 µL

CHADL Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CF®680 Tetrazine
#96097 1x 1 mg

CF®680 Tetrazine

Sign In for Pricing
View Details
TagFP, AlpHcAbs® Rabbit antibody (HRP)
HA710078 100 µg

TagFP, AlpHcAbs® Rabbit antibody (HRP)

Sign In for Pricing
View Details