Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C18orf10 Rabbit Polyclonal Antibody (Biotin)

C18orf10 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

L17, PGs2, C18orf10, HMFN0601

UniProt

Q68CL5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C18orf10

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SMYSLPNAPTLADLEDDTHEASDDQPEKPHFDSRSVIFELDSCNGSGKVC

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_056291

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human CLIP1 shRNA (UAS) - Lentiviral human CLIP1 shRNA (UAS, iRFP) plasmid
GTR15324031 1 Vial

Lentiviral human CLIP1 shRNA (UAS) - Lentiviral human CLIP1 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Human ANKRD55 activation kit by CRISPRa
GA112576 1 Kit

Human ANKRD55 activation kit by CRISPRa

Sign In for Pricing
View Details
F(ab')2 Donkey anti-Rabbit IgG Heavy and Light Chain Cross-Adsorbed Antibody DyLight 594 Conjugated
MBS3900452-01 0.5 mg

F(ab')2 Donkey anti-Rabbit IgG Heavy and Light Chain Cross-Adsorbed Antibody DyLight 594 Conjugated

Sign In for Pricing
View Details
F(ab')2 Donkey anti-Rabbit IgG Heavy and Light Chain Cross-Adsorbed Antibody DyLight 594 Conjugated
MBS3900452-02 5x 0.5 mg

F(ab')2 Donkey anti-Rabbit IgG Heavy and Light Chain Cross-Adsorbed Antibody DyLight 594 Conjugated

Sign In for Pricing
View Details
ALG13 Antibody Blocking Peptide
orb1513297 500 µg

ALG13 Antibody Blocking Peptide

Sign In for Pricing
View Details
LOC678769 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
27352066 1.0 µg DNA

LOC678769 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details