Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C18orf10 Rabbit Polyclonal Antibody (Biotin)

C18orf10 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

L17, PGs2, C18orf10, HMFN0601

UniProt

Q68CL5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C18orf10

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SMYSLPNAPTLADLEDDTHEASDDQPEKPHFDSRSVIFELDSCNGSGKVC

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_056291

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TUSC1 (NM_001004125) Human Over-expression Lysate
LH03348V 100 µg

TUSC1 (NM_001004125) Human Over-expression Lysate

Sign In for Pricing
View Details
NANS (B-6) : m-IgG2b BP-HRP Bundle
sc-549048 1 Kit

NANS (B-6) : m-IgG2b BP-HRP Bundle

Sign In for Pricing
View Details
Lentiviral mouse Ppy shRNA (UAS) - Lentiviral mouse Ppy shRNA (UAS, RFP) (25)
GTR15193775 1 Vial

Lentiviral mouse Ppy shRNA (UAS) - Lentiviral mouse Ppy shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
P/P023/NT-PP-PHOLUMC-Dia 150/1-B Prohibited Activity Signs (No Adhesive)
836056 1 Pack (1 Panel (s) x 1 Pack)

P/P023/NT-PP-PHOLUMC-Dia 150/1-B Prohibited Activity Signs (No Adhesive)

Sign In for Pricing
View Details
Carrier-free (BSA/glycerol-free) Mouse monoclonal eRFP antibody, clone LBI7C8
AMM08833VCF 100 µg

Carrier-free (BSA/glycerol-free) Mouse monoclonal eRFP antibody, clone LBI7C8

Sign In for Pricing
View Details
Cytokeratin 18 (CK 18) FITC labeled
MM-1009-15 0.5 mL (0.1 mg)

Cytokeratin 18 (CK 18) FITC labeled

Sign In for Pricing
View Details