Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C18orf10 Rabbit Polyclonal Antibody (FITC)

C18orf10 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

L17, PGs2, C18orf10, HMFN0601

UniProt

Q68CL5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C18orf10

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SMYSLPNAPTLADLEDDTHEASDDQPEKPHFDSRSVIFELDSCNGSGKVC

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_056291

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Decorin ELISA Kit
MBS9428541-01 96 Tests

Human Decorin ELISA Kit

Sign In for Pricing
View Details
Human Decorin ELISA Kit
MBS9428541-02 5x 96 Tests

Human Decorin ELISA Kit

Sign In for Pricing
View Details
PSMB7 Antibody
E38QA5608 100 µL

PSMB7 Antibody

Sign In for Pricing
View Details
MIER1, ID (MIER1, KIAA1610, Mesoderm induction early response protein 1)
038431 200 µL

MIER1, ID (MIER1, KIAA1610, Mesoderm induction early response protein 1)

Sign In for Pricing
View Details
FXYD4 Adenovirus (Mouse)
21095054 1.0 mL

FXYD4 Adenovirus (Mouse)

Sign In for Pricing
View Details
SOCS4, ID (SOCS4, SOCS7, Suppressor of cytokine signaling 4, Suppressor of cytokine signaling 7) (PE) discontinued
042132-PE 200 µL

SOCS4, ID (SOCS4, SOCS7, Suppressor of cytokine signaling 4, Suppressor of cytokine signaling 7) (PE) discontinued

Sign In for Pricing
View Details