Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C18orf10 Rabbit Polyclonal Antibody (FITC)

C18orf10 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

L17, PGs2, C18orf10, HMFN0601

UniProt

Q68CL5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C18orf10

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LYWHFLTDTFTAYYRLLITHLGLPQWQYAFTSYGISPQAKQWFSMYKPIT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_056291

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Flipt1 Lentiviral Activation Particles (h2)
sc-412528-LAC-2 200 µL

Flipt1 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
Ccn1 Mouse shRNA Lentiviral Particle (Locus ID 16007)
TL512127V 500 µL Each

Ccn1 Mouse shRNA Lentiviral Particle (Locus ID 16007)

Sign In for Pricing
View Details
TRAX (TSNAX) (NM_005999) Human Tagged ORF Clone Lentiviral Particle
RC204023L1V 200 µL

TRAX (TSNAX) (NM_005999) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Rat Retinol-Binding Protein 4 (RBP4) AssayLite™ Antibody (FITC Conjugate)
13123-05041 2x 75 µg

Rat Retinol-Binding Protein 4 (RBP4) AssayLite™ Antibody (FITC Conjugate)

Sign In for Pricing
View Details
Rabbit Anti-Pneumococcal Type 19F Polysaccharide CRM197 Conjugate PAb
PA2081-01 100 μL

Rabbit Anti-Pneumococcal Type 19F Polysaccharide CRM197 Conjugate PAb

Sign In for Pricing
View Details
Rabbit Anti-Pneumococcal Type 19F Polysaccharide CRM197 Conjugate PAb
PA2081-02 500 μL

Rabbit Anti-Pneumococcal Type 19F Polysaccharide CRM197 Conjugate PAb

Sign In for Pricing
View Details