Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Kbtbd2 Rabbit Polyclonal Antibody (HRP)

Kbtbd2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Bklhd, Bklhd1, BC022962, mKIAA1489

UniProt

Q8R1W9

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Kbtbd2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SSDNLNVEKEETVREAAMLWLEYNTESRSQYLSSVLSQIRIDALSEVTQR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_666070

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Histidine Rich Calcium Binding Protein (HRC) ELISA Kit
orb777596-01 48 Tests

Human Histidine Rich Calcium Binding Protein (HRC) ELISA Kit

Sign In for Pricing
View Details
Human Histidine Rich Calcium Binding Protein (HRC) ELISA Kit
orb777596-02 96 Tests

Human Histidine Rich Calcium Binding Protein (HRC) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human Regulator of G-protein signaling 2(RGS2)
AP70715-01 20 µg

Recombinant Human Regulator of G-protein signaling 2(RGS2)

Sign In for Pricing
View Details
Recombinant Human Regulator of G-protein signaling 2(RGS2)
AP70715-02 100 µg

Recombinant Human Regulator of G-protein signaling 2(RGS2)

Sign In for Pricing
View Details
Recombinant Human Regulator of G-protein signaling 2(RGS2)
AP70715-03 1 mg

Recombinant Human Regulator of G-protein signaling 2(RGS2)

Sign In for Pricing
View Details
Rat Hepatocyte Growth Factor (HGF) ELISA Kit
RDR-HGF-Ra-48Tests 48 Tests

Rat Hepatocyte Growth Factor (HGF) ELISA Kit

Sign In for Pricing
View Details