Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Kbtbd2 Rabbit Polyclonal Antibody (HRP)

Kbtbd2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Bklhd, Bklhd1, BC022962, mKIAA1489

UniProt

Q8R1W9

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Kbtbd2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SSDNLNVEKEETVREAAMLWLEYNTESRSQYLSSVLSQIRIDALSEVTQR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_666070

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

H1FNT (N-Term) Rabbit pAb
E2619394 100 µL

H1FNT (N-Term) Rabbit pAb

Sign In for Pricing
View Details
ATP6V1G1 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
12798064 1.0 µg DNA

ATP6V1G1 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Chicken Liver Fatty Acid Binding Protein (L-FABP) ELISA Kit
EIA06652Ch 1 Kit

Chicken Liver Fatty Acid Binding Protein (L-FABP) ELISA Kit

Sign In for Pricing
View Details
5-Nitro-1H-indazole-7-carboxylic acid
sc-290962 250 mg

5-Nitro-1H-indazole-7-carboxylic acid

Sign In for Pricing
View Details
Mouse Monoclonal PP2C beta/PPM1B Antibody (OTI3C9) [Alexa Fluor 350]
NBP2-73548AF350 0.1 mL

Mouse Monoclonal PP2C beta/PPM1B Antibody (OTI3C9) [Alexa Fluor 350]

Sign In for Pricing
View Details
Human ORM1-Like 3 (ORMDL3) ELISA Kit
MBS109615-01 48 Well

Human ORM1-Like 3 (ORMDL3) ELISA Kit

Sign In for Pricing
View Details